PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Mapoly0098s0044.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Marchantiophyta; Marchantiopsida; Marchantiidae; Marchantiales; Marchantiaceae; Marchantia
Family G2-like
Protein Properties Length: 301aa    MW: 32466.5 Da    PI: 8.3316
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Mapoly0098s0044.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like109.81.3e-344599155
              G2-like  1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                         kprlrWtpeLHerFv+av+qLGG++kAtPk+++++m+vkgLtl+h+kSHLQkYRl
  Mapoly0098s0044.1.p 45 KPRLRWTPELHERFVDAVTQLGGADKATPKSVMRVMGVKGLTLYHLKSHLQKYRL 99
                         79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.24342102IPR017930Myb domain
Gene3DG3DSA:1.10.10.606.3E-3443100IPR009057Homeodomain-like
TIGRFAMsTIGR015573.8E-2445100IPR006447Myb domain, plants
SuperFamilySSF466892.87E-1745100IPR009057Homeodomain-like
PfamPF002493.7E-94798IPR001005SANT/Myb domain
PfamPF143791.8E-26142188IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010628Biological Processpositive regulation of gene expression
GO:0016036Biological Processcellular response to phosphate starvation
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 301 aa     Download sequence    Send to blast
MYQMKKYSNT SLVPHRGQTS SQQERSMYGG SLPGDAGVVT SADPKPRLRW TPELHERFVD  60
AVTQLGGADK ATPKSVMRVM GVKGLTLYHL KSHLQKYRLG KQLHKEVNVE TIKDQGSSEG  120
QGPSSGTATD CVITQNPKES LQITEALRLQ MEVQKRLHEQ LEVQRHLQLR IEAQGKYLQS  180
ILEKARETLA GHTAASPGLE AAHAELSDLA SKVTTENLSP AFSLTGVPSM SMPSLTVAEL  240
SVRGGEQQCG GVPHQLSSPN PQSRLSDCSS QSYLTSLACS GNPDGNEPSD QKQNTGKLPG  300
*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00378DAPTransfer from AT3G24120Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_001754451.13e-90predicted protein
SwissprotQ9SAK54e-64APL_ARATH; Myb family transcription factor APL
TrEMBLC0PPV32e-90C0PPV3_PICSI; Putative uncharacterized protein
STRINGPP1S13_270V6.12e-93(Physcomitrella patens)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP7817262
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G24120.11e-78G2-like family protein